| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) ![]() |
| Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
| Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (18 species) |
| Species Spinach (Spinacia oleracea) [TaxId:3562] [69409] (8 PDB entries) |
| Domain d2pkqs1: 2pkq S:0-148,S:313-332 [139714] Other proteins in same PDB: d2pkqp2, d2pkqr2, d2pkqs2 automatically matched to d1nboa1 complexed with ndp, so4 |
PDB Entry: 2pkq (more details), 3.6 Å
SCOP Domain Sequences for d2pkqs1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pkqs1 c.2.1.3 (S:0-148,S:313-332) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]}
klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
itapgkgdiptyvvgvneegythadtiisnasXnewgysqrvvdladivankw
Timeline for d2pkqs1:
View in 3DDomains from other chains: (mouse over for more information) d2pkqp1, d2pkqp2, d2pkqr1, d2pkqr2 |