SCOPe 2.08: Domain d2pd4b_: 2pd4 B:

Lineage for d2pd4b_ (2pd4 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
   has additional subdomain(s) that are not in the common domain
   

6. Protein Enoyl-ACP reductase [51791] (11 species)

7. Species Helicobacter pylori [TaxId:210] [102151] (4 PDB entries)

8. Domain d2pd4b_: 2pd4 B: [139661]
   automated match to d1jvfa_
   complexed with dcn, nad

Details for d2pd4b_

PDB Entry: 2pd4, 2.3 Å

PDB Description: Crystal Structure of the Helicobacter pylori Enoyl-Acyl Carrier Protein Reductase in Complex with Hydroxydiphenyl Ether Compounds, Triclosan and Diclosan

PDB Compounds: (B:) Enoyl-[acyl-carrier-protein] reductase [NADH]

SCOPe Domain Sequences for d2pd4b_:

Sequence; same for both SEQRES and ATOM records:

>d2pd4b_ c.2.1.2 (B:) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]}
gflkgkkglivgvannksiaygiaqscfnqgatlaftylneslekrvrpiaqelnspyvy
eldvskeehfkslynsvkkdlgsldfivhsvafapkealegslletsksafntameisvy
slieltntlkpllnngasvltlsylgstkymahynvmglakaalesavrylavdlgkhhi
rvnalsagpirtlassgiadfrmilkwneinaplrknvsleevgnagmyllsslssgvsg
evhfvdagyhvmgmgaveekdnkatllwdlhkeq

Timeline for d2pd4b_:

• d2pd4b_ first appeared in SCOP 1.73, called d2pd4b1
  
• d2pd4b_ appears in SCOPe 2.07