| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
| Protein Actin-related protein 3, Arp3 [69528] (1 species) part of Arp2/3 complex |
| Species Cow (Bos taurus) [TaxId:9913] [69529] (16 PDB entries) Uniprot P61158 |
| Domain d2p9ua1: 2p9u A:3-160 [139630] Other proteins in same PDB: d2p9ub1, d2p9uc_, d2p9ud1, d2p9ud2, d2p9ue_, d2p9uf_, d2p9ug_ automated match to d1k8ka1 complexed with anp, ca |
PDB Entry: 2p9u (more details), 2.75 Å
SCOPe Domain Sequences for d2p9ua1:
Sequence, based on SEQRES records: (download)
>d2p9ua1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]}
grlpacvvdcgtgytklgyagntepqfiipsciaikesakvgdqaqrrvmkgvddldffi
gdeaiekptyatkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpen
reytaeimfesfnvpglyiavqavlalaaswtsrqvge
>d2p9ua1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]}
grlpacvvdcgtgytklgyagntepqfiipsciaikevmkgvddldffigdeaiekptya
tkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpenreytaeimfes
fnvpglyiavqavlalaaswtsqvge
Timeline for d2p9ua1: