Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families) duplication contains two domains of this fold |
Family c.55.1.1: Actin/HSP70 [53068] (7 proteins) |
Protein Actin-related protein 3, Arp3 [69528] (1 species) part of Arp2/3 complex |
Species Cow (Bos taurus) [TaxId:9913] [69529] (10 PDB entries) |
Domain d2p9ua1: 2p9u A:3-160 [139630] Other proteins in same PDB: d2p9uc1, d2p9ud1, d2p9ud2, d2p9ue1, d2p9uf1, d2p9ug1 automatically matched to d1tyqa1 complexed with anp, ca |
PDB Entry: 2p9u (more details), 2.75 Å
SCOP Domain Sequences for d2p9ua1:
Sequence, based on SEQRES records: (download)
>d2p9ua1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} grlpacvvdcgtgytklgyagntepqfiipsciaikesakvgdqaqrrvmkgvddldffi gdeaiekptyatkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpen reytaeimfesfnvpglyiavqavlalaaswtsrqvge
>d2p9ua1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} grlpacvvdcgtgytklgyagntepqfiipsciaikevmkgvddldffigdeaiekptya tkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpenreytaeimfes fnvpglyiavqavlalaaswtsqvge
Timeline for d2p9ua1: