![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
![]() | Protein Actin-related protein 3, Arp3 [69528] (1 species) part of Arp2/3 complex |
![]() | Species Cow (Bos taurus) [TaxId:9913] [69529] (16 PDB entries) Uniprot P61158 |
![]() | Domain d2p9la1: 2p9l A:2-160 [139598] Other proteins in same PDB: d2p9lb_, d2p9lc_, d2p9ld1, d2p9ld2, d2p9le_, d2p9lf_, d2p9lg_ automated match to d1u2va1 |
PDB Entry: 2p9l (more details), 2.65 Å
SCOPe Domain Sequences for d2p9la1:
Sequence, based on SEQRES records: (download)
>d2p9la1 c.55.1.1 (A:2-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} agrlpacvvdcgtgytklgyagntepqfiipsciaikesakvgdqaqrrvmkgvddldff igdeaiekptyatkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpe nreytaeimfesfnvpglyiavqavlalaaswtsrqvge
>d2p9la1 c.55.1.1 (A:2-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} agrlpacvvdcgtgytklgyagntepqfiipsciaikevmkgvddldffigdeaiekpty atkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpenreytaeimfe sfnvpglyiavqavlalaaswtsqvge
Timeline for d2p9la1: