Lineage for d2p9ke_ (2p9k E:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1751838Fold a.148: Arp2/3 complex 21 kDa subunit ARPC3 [69059] (1 superfamily)
    5 helices; one helix is surrounded by the others
  4. 1751839Superfamily a.148.1: Arp2/3 complex 21 kDa subunit ARPC3 [69060] (1 family) (S)
    automatically mapped to Pfam PF04062
  5. 1751840Family a.148.1.1: Arp2/3 complex 21 kDa subunit ARPC3 [69061] (2 proteins)
  6. 1751848Protein automated matches [190347] (1 species)
    not a true protein
  7. 1751849Species Cow (Bos taurus) [TaxId:9913] [187174] (12 PDB entries)
  8. 1751851Domain d2p9ke_: 2p9k E: [139595]
    Other proteins in same PDB: d2p9ka1, d2p9ka2, d2p9kc_, d2p9kd1, d2p9kd2, d2p9kf_, d2p9kg_
    automated match to d1k8ke_
    complexed with atp, ca

Details for d2p9ke_

PDB Entry: 2p9k (more details), 2.59 Å

PDB Description: crystal structure of bovine arp2/3 complex co-crystallized with atp and crosslinked with glutaraldehyde
PDB Compounds: (E:) Actin-related protein 2/3 complex subunit 3

SCOPe Domain Sequences for d2p9ke_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p9ke_ a.148.1.1 (E:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
payhsslmdpdtklignmallpirsqfkgpapretkdtdivdeaiyyfkanvffknyeik
neadrtliyitlyiseclkklqkcnsksqgekemytlgitnfpipgepgfplnaiyakpa
nkqedevmraylqqlrqetglrlcekvfdpqndkpskwwtcfvkrqfmnkslsg

SCOPe Domain Coordinates for d2p9ke_:

Click to download the PDB-style file with coordinates for d2p9ke_.
(The format of our PDB-style files is described here.)

Timeline for d2p9ke_: