Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) |
Family c.23.12.1: Formate/glycerate dehydrogenases, substrate-binding domain [52284] (7 proteins) this domain is interrupted by the Rossmann-fold domain |
Protein Phosphoglycerate dehydrogenase [52293] (2 species) has additional C-terminal domain of the ferredoxin fold |
Species Escherichia coli [TaxId:562] [52294] (7 PDB entries) |
Domain d2p9ed2: 2p9e D:8-107,D:296-326 [139572] Other proteins in same PDB: d2p9ea1, d2p9ea3, d2p9eb1, d2p9eb3, d2p9ec1, d2p9ec3, d2p9ed1, d2p9ed3 automatically matched to d1psda2 complexed with cit, nai, po4, so4; mutant |
PDB Entry: 2p9e (more details), 2.6 Å
SCOP Domain Sequences for d2p9ed2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p9ed2 c.23.12.1 (D:8-107,D:296-326) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} kdkikfllvegvhqkaleslraagytniefhkgalddeqlkesirdahfiglrsrthlte dvinaaeklvaigafaigtnqvdldaaakrgipvfnapfsXstqeaqeniglevagklik ysdngstlsavn
Timeline for d2p9ed2: