Lineage for d2p9ed2 (2p9e D:8-107,D:296-326)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 825505Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 826403Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 826404Family c.23.12.1: Formate/glycerate dehydrogenases, substrate-binding domain [52284] (7 proteins)
    this domain is interrupted by the Rossmann-fold domain
  6. 826428Protein Phosphoglycerate dehydrogenase [52293] (2 species)
    has additional C-terminal domain of the ferredoxin fold
  7. 826429Species Escherichia coli [TaxId:562] [52294] (7 PDB entries)
  8. 826445Domain d2p9ed2: 2p9e D:8-107,D:296-326 [139572]
    Other proteins in same PDB: d2p9ea1, d2p9ea3, d2p9eb1, d2p9eb3, d2p9ec1, d2p9ec3, d2p9ed1, d2p9ed3
    automatically matched to d1psda2
    complexed with cit, nai, po4, so4; mutant

Details for d2p9ed2

PDB Entry: 2p9e (more details), 2.6 Å

PDB Description: crystal structure of g336v mutant of e.coli phosphoglycerate dehydrogenase
PDB Compounds: (D:) D-3-phosphoglycerate dehydrogenase

SCOP Domain Sequences for d2p9ed2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p9ed2 c.23.12.1 (D:8-107,D:296-326) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]}
kdkikfllvegvhqkaleslraagytniefhkgalddeqlkesirdahfiglrsrthlte
dvinaaeklvaigafaigtnqvdldaaakrgipvfnapfsXstqeaqeniglevagklik
ysdngstlsavn

SCOP Domain Coordinates for d2p9ed2:

Click to download the PDB-style file with coordinates for d2p9ed2.
(The format of our PDB-style files is described here.)

Timeline for d2p9ed2: