Lineage for d2p8zt1 (2p8z T:344-481)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543994Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1544037Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 1544038Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 1544039Protein Elongation factor 2 (eEF-2), domain II [82118] (1 species)
  7. 1544040Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82119] (13 PDB entries)
    Uniprot P32324
  8. 1544062Domain d2p8zt1: 2p8z T:344-481 [139551]
    Other proteins in same PDB: d2p8zt2, d2p8zt3, d2p8zt4, d2p8zt5
    automatically matched to d1n0ua1
    complexed with apr, gnp, so1

Details for d2p8zt1

PDB Entry: 2p8z (more details), 8.9 Å

PDB Description: fitted structure of adpr-eef2 in the 80s:adpr-eef2:gdpnp:sordarin cryo-em reconstruction
PDB Compounds: (T:) Elongation factor 2

SCOPe Domain Sequences for d2p8zt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p8zt1 b.43.3.1 (T:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
spvtaqayraeqlyegpaddanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfag
tvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfl
lktgtlttsetahnmkvm

SCOPe Domain Coordinates for d2p8zt1:

Click to download the PDB-style file with coordinates for d2p8zt1.
(The format of our PDB-style files is described here.)

Timeline for d2p8zt1: