Class b: All beta proteins [48724] (174 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.3: Translation proteins [50447] (6 families) |
Family b.43.3.1: Elongation factors [50448] (10 proteins) |
Protein Elongation factor 2 (eEF-2), domain II [82118] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82119] (13 PDB entries) Uniprot P32324 |
Domain d2p8xt1: 2p8x T:344-481 [139541] Other proteins in same PDB: d2p8xt2, d2p8xt3, d2p8xt4, d2p8xt5 automatically matched to d1n0ua1 complexed with apr, dde, gnp |
PDB Entry: 2p8x (more details), 9.7 Å
SCOP Domain Sequences for d2p8xt1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p8xt1 b.43.3.1 (T:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} spvtaqayraeqlyegpaddanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfag tvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfl lktgtlttsetahnmkvm
Timeline for d2p8xt1:
View in 3D Domains from same chain: (mouse over for more information) d2p8xt2, d2p8xt3, d2p8xt4, d2p8xt5 |