SCOP 1.75: Domain d2p8xt1: 2p8x T:344-481

Lineage for d2p8xt1 (2p8x T:344-481)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (6 families)

5. Family b.43.3.1: Elongation factors [50448] (10 proteins)

6. Protein Elongation factor 2 (eEF-2), domain II [82118] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82119] (13 PDB entries)
   Uniprot P32324

8. Domain d2p8xt1: 2p8x T:344-481 [139541]
   Other proteins in same PDB: d2p8xt2, d2p8xt3, d2p8xt4, d2p8xt5
   automatically matched to d1n0ua1
   complexed with apr, dde, gnp

Details for d2p8xt1

PDB Entry: 2p8x, 9.7 Å

PDB Description: fitted structure of adpr-eef2 in the 80s:adpr-eef2:gdpnp cryo-em reconstruction

PDB Compounds: (T:) Elongation factor 2

SCOP Domain Sequences for d2p8xt1:

Sequence; same for both SEQRES and ATOM records:

>d2p8xt1 b.43.3.1 (T:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
spvtaqayraeqlyegpaddanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfag
tvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfl
lktgtlttsetahnmkvm

Timeline for d2p8xt1:

• d2p8xt1 first appeared in SCOP 1.73
  
• d2p8xt1 appears in SCOPe 2.01
  
• d2p8xt1 appears in the current release, SCOPe 2.08