![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.3: Translation proteins [50447] (6 families) ![]() |
![]() | Family b.43.3.1: Elongation factors [50448] (10 proteins) |
![]() | Protein Elongation factor 2 (eEF-2), domain II [82118] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82119] (13 PDB entries) Uniprot P32324 |
![]() | Domain d1n0ua1: 1n0u A:344-481 [79757] Other proteins in same PDB: d1n0ua2, d1n0ua3, d1n0ua4, d1n0ua5 complexed with so1 |
PDB Entry: 1n0u (more details), 2.12 Å
SCOP Domain Sequences for d1n0ua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n0ua1 b.43.3.1 (A:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} spvtaqayraeqlyegpaddanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfag tvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfl lktgtlttsetahnmkvm
Timeline for d1n0ua1:
![]() Domains from same chain: (mouse over for more information) d1n0ua2, d1n0ua3, d1n0ua4, d1n0ua5 |