Lineage for d2p8xt1 (2p8x T:344-481)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 669479Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 669499Superfamily b.43.3: Translation proteins [50447] (5 families) (S)
  5. 669500Family b.43.3.1: Elongation factors [50448] (10 proteins)
  6. 669501Protein Elongation factor 2 (eEF-2), domain II [82118] (1 species)
  7. 669502Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82119] (13 PDB entries)
  8. 669523Domain d2p8xt1: 2p8x T:344-481 [139541]
    Other proteins in same PDB: d2p8xt2, d2p8xt3, d2p8xt4, d2p8xt5
    automatically matched to d1n0ua1
    complexed with apr, dde, gnp

Details for d2p8xt1

PDB Entry: 2p8x (more details), 9.7 Å

PDB Description: fitted structure of adpr-eef2 in the 80s:adpr-eef2:gdpnp cryo-em reconstruction
PDB Compounds: (T:) Elongation factor 2

SCOP Domain Sequences for d2p8xt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p8xt1 b.43.3.1 (T:344-481) Elongation factor 2 (eEF-2), domain II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
spvtaqayraeqlyegpaddanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfag
tvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfl
lktgtlttsetahnmkvm

SCOP Domain Coordinates for d2p8xt1:

Click to download the PDB-style file with coordinates for d2p8xt1.
(The format of our PDB-style files is described here.)

Timeline for d2p8xt1: