| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) ![]() |
| Family d.14.1.1: Translational machinery components [54212] (4 proteins) |
| Protein Elongation factor 2 (eEF-2), domain IV [82575] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82576] (16 PDB entries) Uniprot P32324 |
| Domain d2p8wt3: 2p8w T:561-724 [139538] Other proteins in same PDB: d2p8wt1, d2p8wt2, d2p8wt4, d2p8wt5 automatically matched to d1n0ua3 complexed with gnp |
PDB Entry: 2p8w (more details), 11.3 Å
SCOPe Domain Sequences for d2p8wt3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p8wt3 d.14.1.1 (T:561-724) Elongation factor 2 (eEF-2), domain IV {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararima
ddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifgee
mrsvrvnildvtlhadaihrgggqiiptmrratyagflladpki
Timeline for d2p8wt3:
View in 3DDomains from same chain: (mouse over for more information) d2p8wt1, d2p8wt2, d2p8wt4, d2p8wt5 |