| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) | 
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2  | 
Superfamily d.58.11: EF-G C-terminal domain-like [54980] (3 families) ![]()  | 
| Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (2 proteins) domain III structure is lacking some of the superfamily characters and is often disordered in crystals  | 
| Protein Elongation factor 2 (eEF-2) [82677] (1 species) | 
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82678] (16 PDB entries) Uniprot P32324  | 
| Domain d2p8wt5: 2p8w T:730-842 [139540] Other proteins in same PDB: d2p8wt1, d2p8wt2, d2p8wt3 automatically matched to d1n0ua5 complexed with gnp  | 
PDB Entry: 2p8w (more details), 11.3 Å
SCOPe Domain Sequences for d2p8wt5:
Sequence, based on SEQRES records: (download)
>d2p8wt5 d.58.11.1 (T:730-842) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgftgelrqatg
gqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl
>d2p8wt5 d.58.11.1 (T:730-842) Elongation factor 2 (eEF-2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lveiqcpeqavggiysvlnkkrgqvvseeqtplftvkaylpvnesfgftgelrqatggqa
fpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyydkl
Timeline for d2p8wt5:
 View in 3DDomains from same chain: (mouse over for more information) d2p8wt1, d2p8wt2, d2p8wt3, d2p8wt4  |