SCOP 1.73: Domain d2p8wt3: 2p8w T:561-724

Lineage for d2p8wt3 (2p8w T:561-724)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families)

5. Family d.14.1.1: Translational machinery components [54212] (4 proteins)

6. Protein Elongation factor 2 (eEF-2), domain IV [82575] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82576] (13 PDB entries)

8. Domain d2p8wt3: 2p8w T:561-724 [139538]
   Other proteins in same PDB: d2p8wt1, d2p8wt2, d2p8wt4, d2p8wt5
   automatically matched to d1n0ua3
   complexed with gnp

Details for d2p8wt3

PDB Entry: 2p8w

PDB Description: fitted structure of eef2 in the 80s:eef2:gdpnp cryo-em reconstruction

PDB Compounds: (T:) Elongation factor 2

SCOP Domain Sequences for d2p8wt3:

Sequence; same for both SEQRES and ATOM records:

>d2p8wt3 d.14.1.1 (T:561-724) Elongation factor 2 (eEF-2), domain IV {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararima
ddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifgee
mrsvrvnildvtlhadaihrgggqiiptmrratyagflladpki

Timeline for d2p8wt3:

• d2p8wt3 is new in SCOP 1.73
  
• d2p8wt3 appears in SCOP 1.75
  
• d2p8wt3 appears in the current release, SCOPe 2.08