Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
Superfamily d.159.1: Metallo-dependent phosphatases [56300] (10 families) different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
Family d.159.1.3: Protein serine/threonine phosphatase [56310] (5 proteins) |
Protein Protein phosphatase-2B (PP-2B, calcineurin A subunit) [56313] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [56315] (4 PDB entries) |
Domain d2p6bc1: 2p6b C:14-370 [139513] Other proteins in same PDB: d2p6bb1, d2p6bd1 automatically matched to d1m63a_ complexed with ca, fe, nh2, po4, zn |
PDB Entry: 2p6b (more details), 2.3 Å
SCOP Domain Sequences for d2p6bc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p6bc1 d.159.1.3 (C:14-370) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]} tdrvvkavpfppshrltakevfdndgkprvdilkahlmkegrleesvalriitegasilr qeknlldidapvtvcgdihgqffdlmklfevggspantrylflgdyvdrgyfsiecvlyl walkilypktlfllrgnhecrhlteyftfkqeckikyservydacmdafdclplaalmnq qflcvhgglspeintlddirkldrfkeppaygpmcdilwsdpledfgnektqehfthntv rgcsyfysypavceflqhnnllsilraheaqdagyrmyrksqttgfpslitifsapnyld vynnkaavlkyennvmnirqfncsphpywlpnfmdvftwslpfvgekvtemlvnvln
Timeline for d2p6bc1: