SCOP 1.73: Domain d2p6ba1: 2p6b A:14-370

Lineage for d2p6ba1 (2p6b A:14-370)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (10 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.3: Protein serine/threonine phosphatase [56310] (5 proteins)

6. Protein Protein phosphatase-2B (PP-2B, calcineurin A subunit) [56313] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56315] (4 PDB entries)

8. Domain d2p6ba1: 2p6b A:14-370 [139511]
   Other proteins in same PDB: d2p6bb1, d2p6bd1
   automatically matched to d1m63a_
   complexed with ca, fe, nh2, po4, zn

Details for d2p6ba1

PDB Entry: 2p6b, 2.3 Å

PDB Description: crystal structure of human calcineurin in complex with pvivit peptide

PDB Compounds: (A:) Calmodulin-dependent calcineurin A subunit alpha isoform

SCOP Domain Sequences for d2p6ba1:

Sequence; same for both SEQRES and ATOM records:

>d2p6ba1 d.159.1.3 (A:14-370) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]}
tdrvvkavpfppshrltakevfdndgkprvdilkahlmkegrleesvalriitegasilr
qeknlldidapvtvcgdihgqffdlmklfevggspantrylflgdyvdrgyfsiecvlyl
walkilypktlfllrgnhecrhlteyftfkqeckikyservydacmdafdclplaalmnq
qflcvhgglspeintlddirkldrfkeppaygpmcdilwsdpledfgnektqehfthntv
rgcsyfysypavceflqhnnllsilraheaqdagyrmyrksqttgfpslitifsapnyld
vynnkaavlkyennvmnirqfncsphpywlpnfmdvftwslpfvgekvtemlvnvln

Timeline for d2p6ba1:

• d2p6ba1 is new in SCOP 1.73
  
• d2p6ba1 appears in SCOP 1.75
  
• d2p6ba1 appears in the current release, SCOPe 2.08, called d2p6ba_