SCOP 1.73: Domain d2p6bb1: 2p6b B:15-160

Lineage for d2p6bb1 (2p6b B:15-160)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (11 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Calcineurin regulatory subunit (B-chain) [47530] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47531] (2 PDB entries)

8. Domain d2p6bb1: 2p6b B:15-160 [139512]
   Other proteins in same PDB: d2p6ba1, d2p6bc1
   automatically matched to d1tcob_
   complexed with ca, fe, nh2, po4, zn

Details for d2p6bb1

PDB Entry: 2p6b, 2.3 Å

PDB Description: crystal structure of human calcineurin in complex with pvivit peptide

PDB Compounds: (B:) Calcineurin subunit B isoform 1

SCOP Domain Sequences for d2p6bb1:

Sequence; same for both SEQRES and ATOM records:

>d2p6bb1 a.39.1.5 (B:15-160) Calcineurin regulatory subunit (B-chain) {Cow (Bos taurus) [TaxId: 9913]}
dadeikrlgkrfkkldldnsgslsveefmslpelqqnplvqrvidifdtdgngevdfkef
iegvsqfsvkgdkeqklrfafriydmdkdgyisngelfqvlkmmvgnnlkdtqlqqivdk
tiinadkdgdgrisfeefcavvggld

Timeline for d2p6bb1:

• d2p6bb1 is new in SCOP 1.73
  
• d2p6bb1 appears in SCOP 1.75
  
• d2p6bb1 appears in the current release, SCOPe 2.08