Class g: Small proteins [56992] (100 folds) |
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) |
Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins) |
Protein Activin A (Inhibin beta A) [90170] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [90171] (10 PDB entries) Uniprot P08476 311-426 |
Domain d2p6aa1: 2p6a A:1-116 [139509] automatically matched to d1s4yb_ |
PDB Entry: 2p6a (more details), 3.4 Å
SCOPe Domain Sequences for d2p6aa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p6aa1 g.17.1.2 (A:1-116) Activin A (Inhibin beta A) {Human (Homo sapiens) [TaxId: 9606]} glecdgkvnicckkqffvsfkdigwndwiiapsgyhanycegecpshiagtsgsslsfhs tvinhyrmrghspfanlksccvptklrpmsmlyyddgqniikkdiqnmiveecgcs
Timeline for d2p6aa1: