SCOP 1.73: Domain d2p66a1: 2p66 A:10-91

Lineage for d2p66a1 (2p66 A:10-91)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.60: SAM domain-like [47768] (15 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family)
   contains one classic and one pseudo HhH motifs

5. Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)

6. Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
   topologically similar to the second domain

7. Species Human (Homo sapiens) [TaxId:9606] [47805] (103 PDB entries)

8. Domain d2p66a1: 2p66 A:10-91 [139506]
   Other proteins in same PDB: d2p66a2, d2p66a3
   automatically matched to d1bpxa1
   complexed with 3dr, na, po4

Details for d2p66a1

PDB Entry: 2p66, 2.5 Å

PDB Description: Human DNA Polymerase beta complexed with tetrahydrofuran (abasic site) containing DNA

PDB Compounds: (A:) DNA polymerase beta

SCOP Domain Sequences for d2p66a1:

Sequence; same for both SEQRES and ATOM records:

>d2p66a1 a.60.6.1 (A:10-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens) [TaxId: 9606]}
tlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtki
aekideflatgklrklekirqd

Timeline for d2p66a1:

• d2p66a1 is new in SCOP 1.73
  
• d2p66a1 appears in SCOP 1.75
  
• d2p66a1 appears in the current release, SCOPe 2.08