Lineage for d2p66a2 (2p66 A:92-148)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 642790Fold a.60: SAM domain-like [47768] (15 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 643336Superfamily a.60.12: DNA polymerase beta-like, second domain [81585] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 643337Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
  6. 643338Protein DNA polymerase beta [81579] (2 species)
  7. 643339Species Human (Homo sapiens) [TaxId:9606] [81575] (103 PDB entries)
  8. 643349Domain d2p66a2: 2p66 A:92-148 [139507]
    Other proteins in same PDB: d2p66a1, d2p66a3
    automatically matched to d1bpxa3
    complexed with 3dr, na, po4

Details for d2p66a2

PDB Entry: 2p66 (more details), 2.5 Å

PDB Description: Human DNA Polymerase beta complexed with tetrahydrofuran (abasic site) containing DNA
PDB Compounds: (A:) DNA polymerase beta

SCOP Domain Sequences for d2p66a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p66a2 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens) [TaxId: 9606]}
dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfek

SCOP Domain Coordinates for d2p66a2:

Click to download the PDB-style file with coordinates for d2p66a2.
(The format of our PDB-style files is described here.)

Timeline for d2p66a2: