SCOPe 2.01: Domain d2p4wa_: 2p4w A:

Lineage for d2p4wa_ (2p4w A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.64: PF1790-like [140286] (1 protein)
   sequence similarity to PH1932 in the N-terminal domain; the C-terminal domain provides new dimerisation interface made of a beta-hairpin and a coiled coil

6. Protein Transcriptional regulatory protein PF1790 [140287] (1 species)

7. Species Pyrococcus furiosus [TaxId:2261] [140288] (1 PDB entry)
   Uniprot Q8U030 1-194

8. Domain d2p4wa_: 2p4w A: [139495]
   automated match to d2p4wa1
   complexed with so4

Details for d2p4wa_

PDB Entry: 2p4w, 2.6 Å

PDB Description: Crystal structure of heat shock regulator from Pyrococcus furiosus

PDB Compounds: (A:) Transcriptional regulatory protein arsR family

SCOPe Domain Sequences for d2p4wa_:

Sequence; same for both SEQRES and ATOM records:

>d2p4wa_ a.4.5.64 (A:) Transcriptional regulatory protein PF1790 {Pyrococcus furiosus [TaxId: 2261]}
mgeelnrlldvlgnetrrrilflltkrpyfvselsrelgvgqkavlehlrileeaglies
rvekiprgrprkyymikkglrleilltptlfgsemyeakgvrkspeyeqakeliksqepi
nvkmrelaeflhelnerireiieekreleearilietyientmrrlaeenrqiieeifrd
iekilppgyarslkekf

Timeline for d2p4wa_:

• d2p4wa_ first appeared in SCOP 1.73, called d2p4wa1
  
• d2p4wa_ was called d2p4wa1 in SCOP 1.75
  
• d2p4wa_ appears in SCOPe 2.02
  
• d2p4wa_ appears in the current release, SCOPe 2.08