![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (68 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.64: PF1790-like [140286] (1 protein) sequence similarity to PH1932 in the N-terminal domain; the C-terminal domain provides new dimerisation interface made of a beta-hairpin and a coiled coil |
![]() | Protein Transcriptional regulatory protein PF1790 [140287] (1 species) |
![]() | Species Pyrococcus furiosus [TaxId:2261] [140288] (1 PDB entry) |
![]() | Domain d2p4wa1: 2p4w A:1-194 [139495] automatically matched to 1XNP A:1-194 complexed with so4 |
PDB Entry: 2p4w (more details), 2.6 Å
SCOP Domain Sequences for d2p4wa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p4wa1 a.4.5.64 (A:1-194) Transcriptional regulatory protein PF1790 {Pyrococcus furiosus [TaxId: 2261]} mgeelnrlldvlgnetrrrilflltkrpyfvselsrelgvgqkavlehlrileeaglies rvekiprgrprkyymikkglrleilltptlfgsemyeakgvrkspeyeqakeliksqepi nvkmrelaeflhelnerireiieekreleearilietyientmrrlaeenrqiieeifrd iekilppgyarslk
Timeline for d2p4wa1: