Lineage for d2p4wa1 (2p4w A:1-194)
- Root: SCOP 1.75
Class a: All alpha proteins [46456] (284 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and downSuperfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) 
contains a small beta-sheet (wing)
Family a.4.5.64: PF1790-like [140286] (1 protein)
sequence similarity to PH1932 in the N-terminal domain; the C-terminal domain provides new dimerisation interface made of a beta-hairpin and a coiled coilProtein Transcriptional regulatory protein PF1790 [140287] (1 species) Species Pyrococcus furiosus [TaxId:2261] [140288] (1 PDB entry)
Uniprot Q8U030 1-194
Domain d2p4wa1: 2p4w A:1-194 [139495]
automatically matched to 1XNP A:1-194
complexed with so4
Details for d2p4wa1
PDB Entry: 2p4w (more details), 2.6 Å
PDB Description: Crystal structure of heat shock regulator from Pyrococcus furiosus
PDB Compounds: (A:) Transcriptional regulatory protein arsR familySCOP Domain Sequences for d2p4wa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p4wa1 a.4.5.64 (A:1-194) Transcriptional regulatory protein PF1790 {Pyrococcus furiosus [TaxId: 2261]}
mgeelnrlldvlgnetrrrilflltkrpyfvselsrelgvgqkavlehlrileeaglies
rvekiprgrprkyymikkglrleilltptlfgsemyeakgvrkspeyeqakeliksqepi
nvkmrelaeflhelnerireiieekreleearilietyientmrrlaeenrqiieeifrd
iekilppgyarslk
SCOP Domain Coordinates for d2p4wa1:
Click to download the PDB-style file with coordinates for d2p4wa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2p4wa1:
- d2p4wa1 first appeared in SCOP 1.73
- d2p4wa1 is called d2p4wa_ in SCOPe 2.01
- d2p4wa1 appears in the current release, SCOPe 2.08, called d2p4wa_
View in 3D
