SCOPe 2.05: Domain d2p1ha_: 2p1h A:

Lineage for d2p1ha_ (2p1h A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.77: DEATH domain [47985] (1 superfamily)
   6 helices: closed bundle; greek-key; internal pseudo twofold symmetry

4. Superfamily a.77.1: DEATH domain [47986] (5 families)

5. Family a.77.1.3: Caspase recruitment domain, CARD [81313] (6 proteins)

6. Protein automated matches [190343] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187170] (2 PDB entries)

8. Domain d2p1ha_: 2p1h A: [139457]
   automated match to d1cwwa_
   complexed with zn

Details for d2p1ha_

PDB Entry: 2p1h, 1.59 Å

PDB Description: rapid folding and unfolding of apaf-1 card

PDB Compounds: (A:) Apoptotic protease-activating factor 1

SCOPe Domain Sequences for d2p1ha_:

Sequence; same for both SEQRES and ATOM records:

>d2p1ha_ a.77.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gsmdakarncllqhrealekdiktsyimdhmisdgfltiseeekvrneptqqqraamlik
milkkdndsyvsfynallhegykdlaallhdgip

Timeline for d2p1ha_:

• d2p1ha_ first appeared in SCOP 1.73, called d2p1ha1
  
• d2p1ha_ appears in SCOPe 2.04
  
• d2p1ha_ is called d2p1ha2 in SCOPe 2.06
  
• d2p1ha_ appears in the current release, SCOPe 2.08, called d2p1ha2