![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.77: DEATH domain [47985] (1 superfamily) 6 helices: closed bundle; greek-key; internal pseudo twofold symmetry |
![]() | Superfamily a.77.1: DEATH domain [47986] (5 families) ![]() |
![]() | Family a.77.1.3: Caspase recruitment domain, CARD [81313] (7 proteins) |
![]() | Protein automated matches [190343] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187170] (3 PDB entries) |
![]() | Domain d2p1ha2: 2p1h A:3-94 [139457] Other proteins in same PDB: d2p1ha3 automated match to d1cwwa_ complexed with zn |
PDB Entry: 2p1h (more details), 1.59 Å
SCOPe Domain Sequences for d2p1ha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p1ha2 a.77.1.3 (A:3-94) automated matches {Human (Homo sapiens) [TaxId: 9606]} mdakarncllqhrealekdiktsyimdhmisdgfltiseeekvrneptqqqraamlikmi lkkdndsyvsfynallhegykdlaallhdgip
Timeline for d2p1ha2: