SCOP 1.73: Domain d2p0jb1: 2p0j B:1-203

Lineage for d2p0jb1 (2p0j B:1-203)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (31 families)

5. Family c.52.1.21: Restriction endonuclease BstyI [102471] (1 protein)

6. Protein Restriction endonuclease BstyI [102472] (1 species)
   local sequence similarity to BglII

7. Species Geobacillus stearothermophilus [TaxId:1422] [102473] (3 PDB entries)

8. Domain d2p0jb1: 2p0j B:1-203 [139455]
   automatically matched to d1sdoa_

Details for d2p0jb1

PDB Entry: 2p0j, 2.1 Å

PDB Description: structure of restriction endonuclease bstyi bound to non-cognate dna

PDB Compounds: (B:) BstYI

SCOP Domain Sequences for d2p0jb1:

Sequence, based on SEQRES records:

>d2p0jb1 c.52.1.21 (B:1-203) Restriction endonuclease BstyI {Geobacillus stearothermophilus [TaxId: 1422]}
mrivevyshlngleyiqvhlphiweeiqeiivsidaeacrtkeskektkqgqilyspval
neafkekleakgwkesrtnyyvtadpkliretlslepeeqkkvieaagkealksynqtdf
vkdrvaievqfgkysfvaydlfvkhmafyvsdkidvgveilpmkelskemssgisyyege
lynvirqgrgvpavplvligiap

Sequence, based on observed residues (ATOM records):

>d2p0jb1 c.52.1.21 (B:1-203) Restriction endonuclease BstyI {Geobacillus stearothermophilus [TaxId: 1422]}
mrivevyshlngleyiqvhlphiweeiqeiivsidaeacrtkeskelyspvalneafkek
leakgwkesrtnyyvtadpkliretlslepeeqkkvieaagkealksynqtdfvkdrvai
evqfgkysfvaydlfvkhmafyvsdkidvgveilpmkelskemssgisyyegelynvirq
grgvpavplvligiap

Timeline for d2p0jb1:

• d2p0jb1 is new in SCOP 1.73
  
• d2p0jb1 appears in SCOP 1.75
  
• d2p0jb1 appears in the current release, SCOPe 2.08, called d2p0jb_