![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.52: Restriction endonuclease-like [52979] (3 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
![]() | Superfamily c.52.1: Restriction endonuclease-like [52980] (31 families) ![]() |
![]() | Family c.52.1.21: Restriction endonuclease BstyI [102471] (1 protein) |
![]() | Protein Restriction endonuclease BstyI [102472] (1 species) local sequence similarity to BglII |
![]() | Species Geobacillus stearothermophilus [TaxId:1422] [102473] (3 PDB entries) |
![]() | Domain d1sdoa_: 1sdo A: [98809] |
PDB Entry: 1sdo (more details), 1.85 Å
SCOP Domain Sequences for d1sdoa_:
Sequence, based on SEQRES records: (download)
>d1sdoa_ c.52.1.21 (A:) Restriction endonuclease BstyI {Geobacillus stearothermophilus [TaxId: 1422]} mrivevyshlngleyiqvhlphiweeiqeiivsidaeacrtkeskektkqgqilyspval neafkekleakgwkesrtnyyvtadpkliretlslepeeqkkvieaagkealksynqtdf vkdrvaievqfgkysfvaydlfvkhmafyvsdkidvgveilpmkelskemssgisyyege lynvirqgrgvpavplvligiap
>d1sdoa_ c.52.1.21 (A:) Restriction endonuclease BstyI {Geobacillus stearothermophilus [TaxId: 1422]} mrivevyshlngleyiqvhlphiweeiqeiivsidaeacrtilyspvalneafkekleak gwkesrtnyyvtadpkliretlslepeeqkkvieaagkealksynqtdfvkdrvaievqf gkysfvaydlfvkhmafyvsdkidvgveilpmkelskemssgisyyegelynvirqgrgv pavplvligiap
Timeline for d1sdoa_: