SCOPe 2.08: Domain d2p0jb_: 2p0j B:

Lineage for d2p0jb_ (2p0j B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families)

5. Family c.52.1.21: Restriction endonuclease BstyI [102471] (1 protein)
   automatically mapped to Pfam PF09195

6. Protein Restriction endonuclease BstyI [102472] (1 species)
   local sequence similarity to BglII

7. Species Geobacillus stearothermophilus [TaxId:1422] [102473] (4 PDB entries)

8. Domain d2p0jb_: 2p0j B: [139455]
   automated match to d1sdoa_
   protein/DNA complex

Details for d2p0jb_

PDB Entry: 2p0j, 2.1 Å

PDB Description: structure of restriction endonuclease bstyi bound to non-cognate dna

PDB Compounds: (B:) BstYI

SCOPe Domain Sequences for d2p0jb_:

Sequence, based on SEQRES records:

>d2p0jb_ c.52.1.21 (B:) Restriction endonuclease BstyI {Geobacillus stearothermophilus [TaxId: 1422]}
mrivevyshlngleyiqvhlphiweeiqeiivsidaeacrtkeskektkqgqilyspval
neafkekleakgwkesrtnyyvtadpkliretlslepeeqkkvieaagkealksynqtdf
vkdrvaievqfgkysfvaydlfvkhmafyvsdkidvgveilpmkelskemssgisyyege
lynvirqgrgvpavplvligiap

Sequence, based on observed residues (ATOM records):

>d2p0jb_ c.52.1.21 (B:) Restriction endonuclease BstyI {Geobacillus stearothermophilus [TaxId: 1422]}
mrivevyshlngleyiqvhlphiweeiqeiivsidaeacrtkeskelyspvalneafkek
leakgwkesrtnyyvtadpkliretlslepeeqkkvieaagkealksynqtdfvkdrvai
evqfgkysfvaydlfvkhmafyvsdkidvgveilpmkelskemssgisyyegelynvirq
grgvpavplvligiap

Timeline for d2p0jb_:

• d2p0jb_ first appeared in SCOP 1.73, called d2p0jb1
  
• d2p0jb_ appears in SCOPe 2.07