![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) ![]() automatically mapped to Pfam PF01649 |
![]() | Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein) this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain |
![]() | Protein Ribosomal protein S20 [46994] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [46995] (45 PDB entries) Uniprot P80380 |
![]() | Domain d2ow8u1: 2ow8 u:8-106 [139418] Other proteins in same PDB: d2ow8c1, d2ow8d1, d2ow8d2, d2ow8e1, d2ow8f1, d2ow8f2, d2ow8g1, d2ow8h1, d2ow8i1, d2ow8j1, d2ow8k1, d2ow8l1, d2ow8m1, d2ow8n1, d2ow8o1, d2ow8p1, d2ow8q1, d2ow8r1, d2ow8s1, d2ow8t1, d2ow8v1 protein/RNA complex protein/RNA complex |
PDB Entry: 2ow8 (more details), 3.71 Å
SCOPe Domain Sequences for d2ow8u1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ow8u1 a.7.6.1 (u:8-106) Ribosomal protein S20 {Thermus thermophilus [TaxId: 274]} rnlsalkrhrqslkrrlrnkakksaiktlskkavqlaqegkaeealkimrkaeslidkaa kgstlhknaaarrksrlmrkvrqlleaagapliggglsa
Timeline for d2ow8u1: