Lineage for d2ow8u1 (2ow8 u:8-106)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696503Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2696688Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) (S)
    automatically mapped to Pfam PF01649
  5. 2696689Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
    this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain
  6. 2696690Protein Ribosomal protein S20 [46994] (2 species)
  7. 2696718Species Thermus thermophilus [TaxId:274] [46995] (45 PDB entries)
    Uniprot P80380
  8. 2696759Domain d2ow8u1: 2ow8 u:8-106 [139418]
    Other proteins in same PDB: d2ow8c1, d2ow8d1, d2ow8d2, d2ow8e1, d2ow8f1, d2ow8f2, d2ow8g1, d2ow8h1, d2ow8i1, d2ow8j1, d2ow8k1, d2ow8l1, d2ow8m1, d2ow8n1, d2ow8o1, d2ow8p1, d2ow8q1, d2ow8r1, d2ow8s1, d2ow8t1, d2ow8v1
    protein/RNA complex
    protein/RNA complex

Details for d2ow8u1

PDB Entry: 2ow8 (more details), 3.71 Å

PDB Description: Crystal Structure of a 70S Ribosome-tRNA Complex Reveals Functional Interactions and Rearrangements. This file, 2OW8, contains the 30S ribosome subunit, two tRNA, and mRNA molecules. 50S ribosome subunit is in the file 1VSA.
PDB Compounds: (u:) 30S ribosomal protein S20

SCOPe Domain Sequences for d2ow8u1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ow8u1 a.7.6.1 (u:8-106) Ribosomal protein S20 {Thermus thermophilus [TaxId: 274]}
rnlsalkrhrqslkrrlrnkakksaiktlskkavqlaqegkaeealkimrkaeslidkaa
kgstlhknaaarrksrlmrkvrqlleaagapliggglsa

SCOPe Domain Coordinates for d2ow8u1:

Click to download the PDB-style file with coordinates for d2ow8u1.
(The format of our PDB-style files is described here.)

Timeline for d2ow8u1: