Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily) alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143 |
Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) automatically mapped to Pfam PF00189 |
Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein) |
Protein Ribosomal protein S3 C-terminal domain [54823] (2 species) |
Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries) Uniprot P80372 |
Domain d2ow8d2: 2ow8 d:107-207 [139400] Other proteins in same PDB: d2ow8c1, d2ow8d1, d2ow8e1, d2ow8f1, d2ow8f2, d2ow8g1, d2ow8h1, d2ow8i1, d2ow8j1, d2ow8k1, d2ow8l1, d2ow8m1, d2ow8n1, d2ow8o1, d2ow8p1, d2ow8q1, d2ow8r1, d2ow8s1, d2ow8t1, d2ow8u1, d2ow8v1 protein/RNA complex protein/RNA complex |
PDB Entry: 2ow8 (more details), 3.71 Å
SCOPe Domain Sequences for d2ow8d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ow8d2 d.53.1.1 (d:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]} qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte waaqgrvplhtlranidygfalarttygvlgvkayiflgev
Timeline for d2ow8d2: