Lineage for d2ow8d2 (2ow8 d:107-207)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554405Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
    alpha(2)-beta(4); 2 layers: alpha/beta; antiparallel beta-sheet: order 2143
  4. 2554406Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) (S)
    automatically mapped to Pfam PF00189
  5. 2554407Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)
  6. 2554408Protein Ribosomal protein S3 C-terminal domain [54823] (2 species)
  7. 2554434Species Thermus thermophilus [TaxId:274] [54824] (36 PDB entries)
    Uniprot P80372
  8. 2554466Domain d2ow8d2: 2ow8 d:107-207 [139400]
    Other proteins in same PDB: d2ow8c1, d2ow8d1, d2ow8e1, d2ow8f1, d2ow8f2, d2ow8g1, d2ow8h1, d2ow8i1, d2ow8j1, d2ow8k1, d2ow8l1, d2ow8m1, d2ow8n1, d2ow8o1, d2ow8p1, d2ow8q1, d2ow8r1, d2ow8s1, d2ow8t1, d2ow8u1, d2ow8v1
    protein/RNA complex
    protein/RNA complex

Details for d2ow8d2

PDB Entry: 2ow8 (more details), 3.71 Å

PDB Description: Crystal Structure of a 70S Ribosome-tRNA Complex Reveals Functional Interactions and Rearrangements. This file, 2OW8, contains the 30S ribosome subunit, two tRNA, and mRNA molecules. 50S ribosome subunit is in the file 1VSA.
PDB Compounds: (d:) 30S ribosomal protein S3

SCOPe Domain Sequences for d2ow8d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ow8d2 d.53.1.1 (d:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus [TaxId: 274]}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

SCOPe Domain Coordinates for d2ow8d2:

Click to download the PDB-style file with coordinates for d2ow8d2.
(The format of our PDB-style files is described here.)

Timeline for d2ow8d2: