SCOPe 2.01: Domain d2ovra1: 2ovr A:1085-1159

Lineage for d2ovra1 (2ovr A:1085-1159)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
   multihelical; interlocked heterodimer with F-box proteins

4. Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (1 family)

5. Family a.157.1.1: Skp1 dimerisation domain-like [81380] (2 proteins)

6. Protein Cyclin A/CDK2-associated p45, Skp1 [81378] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [81376] (8 PDB entries)

8. Domain d2ovra1: 2ovr A:1085-1159 [139386]
   Other proteins in same PDB: d2ovra2, d2ovrb1, d2ovrb2
   automatically matched to d1fqvb1
   complexed with so4

Details for d2ovra1

PDB Entry: 2ovr, 2.5 Å

PDB Description: Structure of the Skp1-Fbw7-CyclinEdegN complex

PDB Compounds: (A:) S-phase kinase-associated protein 1A

SCOPe Domain Sequences for d2ovra1:

Sequence; same for both SEQRES and ATOM records:

>d2ovra1 a.157.1.1 (A:1085-1159) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]}
ipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfniknd
fteeeeaqvrkenqw

Timeline for d2ovra1:

• d2ovra1 first appeared in SCOP 1.73
  
• d2ovra1 appears in SCOP 1.75
  
• d2ovra1 appears in SCOPe 2.02
  
• d2ovra1 appears in the current release, SCOPe 2.08