Lineage for d2ovra1 (2ovr A:1085-1159)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 779401Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
    multihelical; interlocked heterodimer with F-box proteins
  4. 779402Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (1 family) (S)
  5. 779403Family a.157.1.1: Skp1 dimerisation domain-like [81380] (2 proteins)
  6. 779408Protein Cyclin A/CDK2-associated p45, Skp1 [81378] (1 species)
  7. 779409Species Human (Homo sapiens) [TaxId:9606] [81376] (8 PDB entries)
  8. 779412Domain d2ovra1: 2ovr A:1085-1159 [139386]
    Other proteins in same PDB: d2ovra2, d2ovrb1, d2ovrb2
    automatically matched to d1fqvb1
    complexed with so4

Details for d2ovra1

PDB Entry: 2ovr (more details), 2.5 Å

PDB Description: Structure of the Skp1-Fbw7-CyclinEdegN complex
PDB Compounds: (A:) S-phase kinase-associated protein 1A

SCOP Domain Sequences for d2ovra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ovra1 a.157.1.1 (A:1085-1159) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]}
ipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfniknd
fteeeeaqvrkenqw

SCOP Domain Coordinates for d2ovra1:

Click to download the PDB-style file with coordinates for d2ovra1.
(The format of our PDB-style files is described here.)

Timeline for d2ovra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ovra2