Lineage for d2ouza_ (2ouz A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2728396Protein Estrogen receptor alpha [48519] (1 species)
  7. 2728397Species Human (Homo sapiens) [TaxId:9606] [48520] (107 PDB entries)
    Uniprot P03372 307-551
  8. 2728527Domain d2ouza_: 2ouz A: [139378]
    automated match to d1qkua_
    complexed with c3d

Details for d2ouza_

PDB Entry: 2ouz (more details), 2 Å

PDB Description: crystal structure of estrogen receptor alpha-lasofoxifene complex
PDB Compounds: (A:) Estrogen receptor

SCOPe Domain Sequences for d2ouza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ouza_ a.123.1.1 (A:) Estrogen receptor alpha {Human (Homo sapiens) [TaxId: 9606]}
lalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrvp
gfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveif
dmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitdt
lihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemld
ahrlha

SCOPe Domain Coordinates for d2ouza_:

Click to download the PDB-style file with coordinates for d2ouza_.
(The format of our PDB-style files is described here.)

Timeline for d2ouza_: