SCOPe 2.08: Domain d2otxa_: 2otx A:

Lineage for d2otxa_ (2otx A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
   Pfam PF00169

6. Protein Src-associated adaptor protein Skap2 [141417] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [141418] (4 PDB entries)
   Uniprot Q9Z2K4 105-212! Uniprot Q9Z2K4 109-219! Uniprot Q9Z2K4 14-222

8. Domain d2otxa_: 2otx A: [139373]
   automated match to d1u5ea1
   has additional subdomain(s) that are not in the common domain

Details for d2otxa_

PDB Entry: 2otx, 2.6 Å

PDB Description: crystal structure of a n-terminal fragment of skap-hom containing both the helical dimerization domain and the ph domain

PDB Compounds: (A:) Src kinase-associated phosphoprotein 2

SCOPe Domain Sequences for d2otxa_:

Sequence, based on SEQRES records:

>d2otxa_ b.55.1.1 (A:) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]}
gspeeirnlladvetfvadtlkgenlskkakekreslikkikdvksvylqefqdkgdaed
gdeyddpfagpadtislaserydkdddgpsdgnqfppiaaqdlpfvikagylekrrkdhs
flgfewqkrwcalsktvfyyygsdkdkqqkgefaidgydvrmnntlrkdgkkdccfeica
pdkriyqftaaspkdaeewvqqlkfilqdlg

Sequence, based on observed residues (ATOM records):

>d2otxa_ b.55.1.1 (A:) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]}
gspeeirnlladvetfvadtlkgenlskkakekreslikkikdvksvylqefqfppiaaq
dlpfvikagylekrrkdhsflgfewqkrwcalsktvfyyygsdkdkqqkgefaidgydvr
mnntlrkdgkkdccfeicapdkriyqftaaspkdaeewvqqlkfilqdlg

Timeline for d2otxa_:

• d2otxa_ first appeared in SCOP 1.73, called d2otxa1
  
• d2otxa_ appears in SCOPe 2.07