Lineage for d2otxb_ (2otx B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803067Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2803309Protein Src-associated adaptor protein Skap2 [141417] (1 species)
  7. 2803310Species Mouse (Mus musculus) [TaxId:10090] [141418] (4 PDB entries)
    Uniprot Q9Z2K4 105-212! Uniprot Q9Z2K4 109-219! Uniprot Q9Z2K4 14-222
  8. 2803313Domain d2otxb_: 2otx B: [139374]
    automated match to d1u5ea1
    has additional subdomain(s) that are not in the common domain

Details for d2otxb_

PDB Entry: 2otx (more details), 2.6 Å

PDB Description: crystal structure of a n-terminal fragment of skap-hom containing both the helical dimerization domain and the ph domain
PDB Compounds: (B:) Src kinase-associated phosphoprotein 2

SCOPe Domain Sequences for d2otxb_:

Sequence, based on SEQRES records: (download)

>d2otxb_ b.55.1.1 (B:) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]}
peeirnlladvetfvadtlkgenlskkakekreslikkikdvksvylqefqdkgdaedgd
eyddpfagpadtislaserydkdddgpsdgnqfppiaaqdlpfvikagylekrrkdhsfl
gfewqkrwcalsktvfyyygsdkdkqqkgefaidgydvrmnntlrkdgkkdccfeicapd
kriyqftaaspkdaeewvqqlkfilqdlg

Sequence, based on observed residues (ATOM records): (download)

>d2otxb_ b.55.1.1 (B:) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]}
peeirnlladvetfvadtlkgenlskkakekreslikkikdvksvylqefqfppiaaqdl
pfvikagylekrrkdhsflgfewqkrwcalsktvfyyygsdkdkqqkgefaidgydvrmn
ntlrkdgkkdccfeicapdkriyqftaaspkdaeewvqqlkfilqdlg

SCOPe Domain Coordinates for d2otxb_:

Click to download the PDB-style file with coordinates for d2otxb_.
(The format of our PDB-style files is described here.)

Timeline for d2otxb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2otxa_