SCOP 1.73: Domain d2oq1a1: 2oq1 A:5-134

Lineage for d2oq1a1 (2oq1 A:5-134)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (1 family)

5. Family d.93.1.1: SH2 domain [55551] (32 proteins)
   Pfam PF00017

6. Protein Tyrosine-protein kinase zap-70 [89996] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89997] (2 PDB entries)

8. Domain d2oq1a1: 2oq1 A:5-134 [139220]
   automatically matched to d1m61a1
   complexed with pb

Details for d2oq1a1

PDB Entry: 2oq1, 1.9 Å

PDB Description: tandem sh2 domains of zap-70 with 19-mer zeta1 peptide

PDB Compounds: (A:) tyrosine-protein kinase zap-70

SCOP Domain Sequences for d2oq1a1:

Sequence; same for both SEQRES and ATOM records:

>d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]}
dpaahlpffygsisraeaeehlklagmadglfllrqclrslggyvlslvhdvrfhhfpie
rqlngtyaiaggkahcgpaelcefysrdpdglpcnlrkpcnrpsglepqpgvfdclrdam
vrdyvrqtwk

Timeline for d2oq1a1:

• d2oq1a1 is new in SCOP 1.73
  
• d2oq1a1 appears in SCOP 1.75
  
• d2oq1a1 appears in the current release, SCOPe 2.08