Lineage for d2oq1a1 (2oq1 A:5-134)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2530460Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2530461Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2530462Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2530887Protein Tyrosine-protein kinase zap-70 [89996] (1 species)
  7. 2530888Species Human (Homo sapiens) [TaxId:9606] [89997] (2 PDB entries)
  8. 2530889Domain d2oq1a1: 2oq1 A:5-134 [139220]
    automatically matched to d1m61a1
    complexed with pb

Details for d2oq1a1

PDB Entry: 2oq1 (more details), 1.9 Å

PDB Description: tandem sh2 domains of zap-70 with 19-mer zeta1 peptide
PDB Compounds: (A:) tyrosine-protein kinase zap-70

SCOPe Domain Sequences for d2oq1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]}
dpaahlpffygsisraeaeehlklagmadglfllrqclrslggyvlslvhdvrfhhfpie
rqlngtyaiaggkahcgpaelcefysrdpdglpcnlrkpcnrpsglepqpgvfdclrdam
vrdyvrqtwk

SCOPe Domain Coordinates for d2oq1a1:

Click to download the PDB-style file with coordinates for d2oq1a1.
(The format of our PDB-style files is described here.)

Timeline for d2oq1a1: