Lineage for d2oq1a2 (2oq1 A:135-258)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 729699Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 729700Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 729701Family d.93.1.1: SH2 domain [55551] (32 proteins)
    Pfam PF00017
  6. 730014Protein Tyrosine-protein kinase zap-70 [89996] (1 species)
  7. 730015Species Human (Homo sapiens) [TaxId:9606] [89997] (2 PDB entries)
  8. 730017Domain d2oq1a2: 2oq1 A:135-258 [139221]
    automatically matched to d1m61a2
    complexed with pb

Details for d2oq1a2

PDB Entry: 2oq1 (more details), 1.9 Å

PDB Description: tandem sh2 domains of zap-70 with 19-mer zeta1 peptide
PDB Compounds: (A:) tyrosine-protein kinase zap-70

SCOP Domain Sequences for d2oq1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]}
legealeqaiisqapqvekliattahermpwyhssltreeaerklysgaqtdgkfllrpr
keqgtyalsliygktvyhylisqdkagkycipegtkfdtlwqlveylklkadgliyclke
acpn

SCOP Domain Coordinates for d2oq1a2:

Click to download the PDB-style file with coordinates for d2oq1a2.
(The format of our PDB-style files is described here.)

Timeline for d2oq1a2: