SCOPe 2.01: Domain d2opya_: 2opy A:

Lineage for d2opya_ (2opy A:)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)

6. Protein BIR domains of XIAP [57928] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57929] (14 PDB entries)
   Uniprot P98170 241-356

8. Domain d2opya_: 2opy A: [139215]
   automated match to d1f9xa_
   complexed with co9, zn

Details for d2opya_

PDB Entry: 2opy, 2.8 Å

PDB Description: Smac mimic bound to BIR3-XIAP

PDB Compounds: (A:) baculoviral iap repeat-containing protein 4

SCOPe Domain Sequences for d2opya_:

Sequence; same for both SEQRES and ATOM records:

>d2opya_ g.52.1.1 (A:) BIR domains of XIAP {Human (Homo sapiens) [TaxId: 9606]}
nfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcggglt
dwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclvr

Timeline for d2opya_:

• d2opya_ first appeared in SCOP 1.73, called d2opya1
  
• d2opya_ was called d2opya1 in SCOP 1.75
  
• d2opya_ appears in SCOPe 2.02
  
• d2opya_ appears in the current release, SCOPe 2.08