PDB entry 2opy

View 2opy on RCSB PDB site
Description: Smac mimic bound to BIR3-XIAP
Class: apoptosis activator
Keywords: Peptide mimic, BIR3, apoptosis activator
Deposited on 2007-01-30, released 2007-02-20
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.213
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: baculoviral iap repeat-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: BIRC4, API3, IAP3, XIAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2opya_
  • Heterogens: ZN, CO9, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2opyA (A:)
nfpnstnlprnpsmadyeariftfgtwiysvnkeqlaragfyalgegdkvkcfhcggglt
dwkpsedpweqhakwypgckylleqkgqeyinnihlthsleeclvr