![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.2: Amine oxidase N-terminal region [54416] (2 families) ![]() |
![]() | Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins) duplication: contains two domains of this fold |
![]() | Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species) |
![]() | Species Yeast (Hansenula polymorpha) [TaxId:4905] [54422] (4 PDB entries) |
![]() | Domain d2oova3: 2oov A:116-236 [139181] Other proteins in same PDB: d2oova1, d2oovb1, d2oovc1, d2oovd1, d2oove1, d2oovf1 automatically matched to d1a2va3 complexed with cu, gol, po4 |
PDB Entry: 2oov (more details), 1.7 Å
SCOPe Domain Sequences for d2oova3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oova3 d.17.2.1 (A:116-236) Copper amine oxidase, domains 1 and 2 {Yeast (Hansenula polymorpha) [TaxId: 4905]} ltvedlcsteevirndpavieqcvlsgipanemhkvycdpwtigyderwgtgkrlqqalv yyrsdeddsqyshpldfcpivdteekkvifidipnrrrkvskhkhanfypkhmiekvgam r
Timeline for d2oova3: