Lineage for d2oovc1 (2oov C:237-672)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2781474Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2781475Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
    automatically mapped to Pfam PF01179
  5. 2781476Family b.30.2.1: Amine oxidase catalytic domain [49999] (3 proteins)
  6. 2781477Protein Copper amine oxidase, domain 3 [50000] (4 species)
  7. 2781583Species Yeast (Hansenula polymorpha) [TaxId:4905] [50004] (4 PDB entries)
  8. 2781592Domain d2oovc1: 2oov C:237-672 [139185]
    Other proteins in same PDB: d2oova2, d2oova3, d2oovb2, d2oovb3, d2oovc2, d2oovc3, d2oovd2, d2oovd3, d2oove2, d2oove3, d2oovf2, d2oovf3
    automatically matched to d1a2va1
    complexed with cu, gol, po4

Details for d2oovc1

PDB Entry: 2oov (more details), 1.7 Å

PDB Description: crystal structure of hansenula polymorpha amine oxidase to 1.7 angstroms
PDB Compounds: (C:) Peroxisomal copper amine oxidase

SCOPe Domain Sequences for d2oovc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oovc1 b.30.2.1 (C:237-672) Copper amine oxidase, domain 3 {Yeast (Hansenula polymorpha) [TaxId: 4905]}
peappinvtqpegvsfkmtgnvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhri
slsemivpygspefphqrkhaldigeygagymtnplslgcdckgvihyldahfsdragdp
itvknavciheeddgllfkhsdfrdnfatslvtratklvvsqiftaanyeyclywvfmqd
gairldirltgilntyilgddeeagpwgtrvypnvnahnhqhlfslridpridgdgnsaa
acdaksspyplgspenmygnafysekttfktvkdsltnyesatgrswdifnpnkvnpysg
kppsyklvstqcppllakegslvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvr
gmrewigdgsenidntdilffhtfgithfpapedfplmpaepitlmlrprhfftenpgld
iqpsyamttseakrav

SCOPe Domain Coordinates for d2oovc1:

Click to download the PDB-style file with coordinates for d2oovc1.
(The format of our PDB-style files is described here.)

Timeline for d2oovc1: