Lineage for d2oovd3 (2oov D:116-236)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. Superfamily d.17.2: Amine oxidase N-terminal region [54416] (2 families) (S)
  5. Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. Species Yeast (Hansenula polymorpha) [TaxId:4905] [54422] (4 PDB entries)
  8. Domain d2oovd3: 2oov D:116-236 [139190]
    Other proteins in same PDB: d2oova1, d2oovb1, d2oovc1, d2oovd1, d2oove1, d2oovf1
    automatically matched to d1a2va3
    complexed with cu, gol, po4

Details for d2oovd3

PDB Entry: 2oov (more details), 1.7000000000000002 Å

PDB Description: crystal structure of hansenula polymorpha amine oxidase to 1.7 angstroms
PDB Compounds: (D:) Peroxisomal copper amine oxidase

SCOPe Domain Sequences for d2oovd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oovd3 d.17.2.1 (D:116-236) Copper amine oxidase, domains 1 and 2 {Yeast (Hansenula polymorpha) [TaxId: 4905]}
ltvedlcsteevirndpavieqcvlsgipanemhkvycdpwtigyderwgtgkrlqqalv
yyrsdeddsqyshpldfcpivdteekkvifidipnrrrkvskhkhanfypkhmiekvgam
r

SCOPe Domain Coordinates for d2oovd3 are not available.

Timeline for d2oovd3:

Domains from same chain:
(mouse over for more information)
d2oovd1, d2oovd2
Domains from other chains:
(mouse over for more information)
d2oova1, d2oova2, d2oova3, d2oovb1, d2oovb2, d2oovb3, d2oovc1, d2oovc2, d2oovc3, d2oove1, d2oove2, d2oove3, d2oovf1, d2oovf2, d2oovf3