| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.15: Internalin Ig-like domain [81295] (3 proteins) truncated fold fused to an LRR domain |
| Protein Internalin A [81973] (1 species) |
| Species Listeria monocytogenes [TaxId:1639] [81974] (10 PDB entries) |
| Domain d2omwa1: 2omw A:417-496 [139149] Other proteins in same PDB: d2omwa2, d2omwb1 automated match to d2omza1 complexed with cl |
PDB Entry: 2omw (more details), 1.85 Å
SCOPe Domain Sequences for d2omwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2omwa1 b.1.18.15 (A:417-496) Internalin A {Listeria monocytogenes [TaxId: 1639]}
wtnapvnykanvsipntvknvtgaliapatisdggsytepditwnlpsytnevsytfsqp
vtigkgtttfsgtvtqplka
Timeline for d2omwa1: