Lineage for d2omwa1 (2omw A:417-496)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1523789Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1524525Family b.1.18.15: Internalin Ig-like domain [81295] (3 proteins)
    truncated fold fused to an LRR domain
  6. 1524526Protein Internalin A [81973] (1 species)
  7. 1524527Species Listeria monocytogenes [TaxId:1639] [81974] (10 PDB entries)
  8. 1524536Domain d2omwa1: 2omw A:417-496 [139149]
    Other proteins in same PDB: d2omwa2, d2omwb1
    automated match to d2omza1
    complexed with cl

Details for d2omwa1

PDB Entry: 2omw (more details), 1.85 Å

PDB Description: crystal structure of inla s192n y369s/mec1 complex
PDB Compounds: (A:) Internalin-A

SCOPe Domain Sequences for d2omwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2omwa1 b.1.18.15 (A:417-496) Internalin A {Listeria monocytogenes [TaxId: 1639]}
wtnapvnykanvsipntvknvtgaliapatisdggsytepditwnlpsytnevsytfsqp
vtigkgtttfsgtvtqplka

SCOPe Domain Coordinates for d2omwa1:

Click to download the PDB-style file with coordinates for d2omwa1.
(The format of our PDB-style files is described here.)

Timeline for d2omwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2omwa2
View in 3D
Domains from other chains:
(mouse over for more information)
d2omwb1