SCOP 1.73: Domain d2omwa1: 2omw A:417-496

Lineage for d2omwa1 (2omw A:417-496)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (20 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.15: Internalin Ig-like domain [81295] (3 proteins)
   truncated fold fused to an LRR domain

6. Protein Internalin A [81973] (1 species)

7. Species Listeria monocytogenes [TaxId:1639] [81974] (6 PDB entries)

8. Domain d2omwa1: 2omw A:417-496 [139149]
   Other proteins in same PDB: d2omwa2
   automatically matched to d1o6sa1
   complexed with cl; mutant

Details for d2omwa1

PDB Entry: 2omw, 1.85 Å

PDB Description: crystal structure of inla s192n y369s/mec1 complex

PDB Compounds: (A:) Internalin-A

SCOP Domain Sequences for d2omwa1:

Sequence; same for both SEQRES and ATOM records:

>d2omwa1 b.1.18.15 (A:417-496) Internalin A {Listeria monocytogenes [TaxId: 1639]}
wtnapvnykanvsipntvknvtgaliapatisdggsytepditwnlpsytnevsytfsqp
vtigkgtttfsgtvtqplka

Timeline for d2omwa1:

• d2omwa1 is new in SCOP 1.73
  
• d2omwa1 appears in SCOP 1.75
  
• d2omwa1 appears in the current release, SCOPe 2.08