Class g: Small proteins [56992] (94 folds) |
Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) |
Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins) Pfam PF00084 |
Protein Complement factor B [144115] (1 species) contains tandemrepeat of three SCR (Sushi) domains |
Species Human (Homo sapiens) [TaxId:9606] [144116] (1 PDB entry) Uniprot P00751 102-162! Uniprot P00751 163-224! Uniprot P00751 34-101 |
Domain d2ok5a2: 2ok5 A:138-199 [139125] Other proteins in same PDB: d2ok5a1, d2ok5a5 complexed with gol, nag |
PDB Entry: 2ok5 (more details), 2.3 Å
SCOPe Domain Sequences for d2ok5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ok5a2 g.18.1.1 (A:138-199) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} gycsnpgipigtrkvgsqyrledsvtyhcsrgltlrgsqrrtcqeggswsgtepscqdsf my
Timeline for d2ok5a2:
View in 3D Domains from same chain: (mouse over for more information) d2ok5a1, d2ok5a3, d2ok5a4, d2ok5a5 |