Lineage for d2ok5a2 (2ok5 A:138-199)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638750Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 2638751Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) (S)
  5. 2638752Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
    Pfam PF00084
  6. 2638948Protein Complement factor B [144115] (1 species)
    contains tandemrepeat of three SCR (Sushi) domains
  7. 2638949Species Human (Homo sapiens) [TaxId:9606] [144116] (1 PDB entry)
    Uniprot P00751 102-162! Uniprot P00751 163-224! Uniprot P00751 34-101
  8. 2638950Domain d2ok5a2: 2ok5 A:138-199 [139125]
    Other proteins in same PDB: d2ok5a1, d2ok5a5
    complexed with gol, nag

Details for d2ok5a2

PDB Entry: 2ok5 (more details), 2.3 Å

PDB Description: human complement factor b
PDB Compounds: (A:) complement factor b

SCOPe Domain Sequences for d2ok5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ok5a2 g.18.1.1 (A:138-199) Complement factor B {Human (Homo sapiens) [TaxId: 9606]}
gycsnpgipigtrkvgsqyrledsvtyhcsrgltlrgsqrrtcqeggswsgtepscqdsf
my

SCOPe Domain Coordinates for d2ok5a2:

Click to download the PDB-style file with coordinates for d2ok5a2.
(The format of our PDB-style files is described here.)

Timeline for d2ok5a2: