SCOPe 2.08: Domain d2ok0h_: 2ok0 H:

Lineage for d2ok0h_ (2ok0 H:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d2ok0h_: 2ok0 H: [139122]
   Other proteins in same PDB: d2ok0l1, d2ok0l2
   automated match to d6shgh_
   protein/DNA complex

Details for d2ok0h_

PDB Entry: 2ok0, 1.89 Å

PDB Description: Fab ED10-DNA complex

PDB Compounds: (H:) Fab ED10 heavy chain

SCOPe Domain Sequences for d2ok0h_:

Sequence; same for both SEQRES and ATOM records:

>d2ok0h_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqleesgpelvkpgasvkisckasgytftdyymnwlrqkpgqglewigwvypgsikyne
kfkdkatltadtsssivymhlssltsddnavyfctrwtygssfdywgegtlltvssaktt
ppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
sssvtvpsstwpsetvtcnvahpasstkvdkkivpr

Timeline for d2ok0h_:

• d2ok0h_ first appeared in SCOP 1.73, called d2ok0h1
  
• d2ok0h_ was called d2ok0h1 in SCOPe 2.07